Genbank accession number: AF052040

Genbank accession number: AF052040 Plant Molecular Biology 37: 1085, 1998. © 1998 Kluwer Academic Publishers. Printed in Belgium. Sequence announcements Authors: Chou, W-M and Kutchan, TM Address: Laboratorium für Molekulare Biologie, Universität München, Karlstrasse 29, 80333 München, Germany Source of sequence: The cDNA was isolated from a ZAPII cDNA library prepared from mRNA isolated from cell suspension cultures of Berberis stolonifera (barberry) 3 days after subculture. The clone was sequenced in pBluescript SK obtained by in vivo excision of the phage  clone. Trivial name: Calreticulin from Berberis stolonifera. Description: The calreticulin cDNA clone is 1547 bp long and encodes a protein of 416 amino acids. The amino acid sequence is 50% identical to calreticulins from the animal kingdom. The cDNA was expressed in Spodoptera frugiperda Sf9 cells and was demonstrated to bind calcium. Acknowledgements: This work was supported by SFB 369 of the Deutsche Forschungsgemeinschaft, Bonn and Fonds der Chemischen Industrie, Frankfurt. 1 100 Bst ...MAIAERRSRSHLALR..VRDRVSAEVFFEERFEDGWESKWVKSDWKRDENMAGEWNFTSGKWNGDANDKGIQTSEDYRFYAISAAFPEFSNKGKTLV Rco .....M NPK L LFL S..LLAIA NR K T Y P E D Npl MATQRR NPS LHLITVFSLLVAV S N R E K H E N Ath ...M KLNPKFI LILFA..LVVI I K KR K D T KH A N S E D Zma ..MAIRKGSSYAVAAL ALASVAA AG Q K E K H E EY D 101 200 Bst FQFSVKHEQKLDCGGGYMKLLSGDVDQKKFGGDTPYSIMFGPDICGYSTKKVHAILTKGETNHLIKKDVPCETDQLTHVYTFILRPDASYSILIDNVEKQ Rco SST NYND E LVI T Npl YND E T Ath D T YNG E V T Zma L V G S T DGK L I T E 201 300 Bst SGSVYTDWDILPPKQIKDPEAKKPEDWEDKEYIPDPEDKKPEGYDDIPKEITDPEAKKPEDWDDEEDGEWTAPTIPNPDYKGEWKPKKIKNPNFKGKWKA Rco T L L K DE P D A E P Y Npl L S L T S DE F D E D E P Y Ath T L S L A K S D T A P TD E N AY Zma T I EH K D P D E P Q YQ 301 400 Bst PMIDNPDFKDDPDIYVFPKLKYVGIELWQVKSGTMFDNVLICDDPDYAKKLAEETWGKNKDAEKAAFDEAEKKKEEEEAKDDPTESD.DEKPDEEGESDG Rco E Y N L N E Q E S AD A DD DADDTE Npl L L V L IV E AI Q E R S AA AD AE DD ADDD .D Ath E EL V SL VS E H R S A A AE EAEDDDNEGD Zma Y A DS I L II T AL TF H E D AKGGDDE D LEDE DD KAD Bst EGDDESKDIDNEE........DDEDVHDEL* Rco D G SDAA D........SA * Npl DA K ESK............. DEA * Ath DS N SEETK AEETKEAEETDAA * Zma DKAD DAE SKDS....... KQ * Figure 1. Alignment of the deduced amino acid sequences of calreticulin from Berberis stolonifera (Bst) with Ricinus communis (Rco), Nicotiana plumbaginifolia (Npl), Arabidopsis thaliana (Ath) and Zea mays (Zma). Plant Molecular Biology Springer Journals

Genbank accession number: AF052040

1 page

Loading next page...
1 Page
Kluwer Academic Publishers
Copyright © 1998 by Kluwer Academic Publishers
Life Sciences; Biochemistry, general; Plant Sciences; Plant Pathology
Publisher site
See Article on Publisher Site

There are no references for this article.

You’re reading a free preview. Subscribe to read the entire article.

DeepDyve is your
personal research library

It’s your single place to instantly
discover and read the research
that matters to you.

Enjoy affordable access to
over 12 million articles from more than
10,000 peer-reviewed journals.

All for just $49/month

Explore the DeepDyve Library

Unlimited reading

Read as many articles as you need. Full articles with original layout, charts and figures. Read online, from anywhere.

Stay up to date

Keep up with your field with Personalized Recommendations and Follow Journals to get automatic updates.

Organize your research

It’s easy to organize your research with our built-in tools.

Your journals are on DeepDyve

Read from thousands of the leading scholarly journals from SpringerNature, Elsevier, Wiley-Blackwell, Oxford University Press and more.

All the latest content is available, no embargo periods.

See the journals in your area

Monthly Plan

  • Read unlimited articles
  • Personalized recommendations
  • No expiration
  • Print 20 pages per month
  • 20% off on PDF purchases
  • Organize your research
  • Get updates on your journals and topic searches


Start Free Trial

14-day Free Trial

Best Deal — 39% off

Annual Plan

  • All the features of the Professional Plan, but for 39% off!
  • Billed annually
  • No expiration
  • For the normal price of 10 articles elsewhere, you get one full year of unlimited access to articles.



billed annually
Start Free Trial

14-day Free Trial