Genbank accession number: AF052040

Genbank accession number: AF052040 Plant Molecular Biology 37: 1085, 1998. © 1998 Kluwer Academic Publishers. Printed in Belgium. Sequence announcements Authors: Chou, W-M and Kutchan, TM Address: Laboratorium für Molekulare Biologie, Universität München, Karlstrasse 29, 80333 München, Germany Source of sequence: The cDNA was isolated from a ZAPII cDNA library prepared from mRNA isolated from cell suspension cultures of Berberis stolonifera (barberry) 3 days after subculture. The clone was sequenced in pBluescript SK obtained by in vivo excision of the phage  clone. Trivial name: Calreticulin from Berberis stolonifera. Description: The calreticulin cDNA clone is 1547 bp long and encodes a protein of 416 amino acids. The amino acid sequence is 50% identical to calreticulins from the animal kingdom. The cDNA was expressed in Spodoptera frugiperda Sf9 cells and was demonstrated to bind calcium. Acknowledgements: This work was supported by SFB 369 of the Deutsche Forschungsgemeinschaft, Bonn and Fonds der Chemischen Industrie, Frankfurt. 1 100 Bst ...MAIAERRSRSHLALR..VRDRVSAEVFFEERFEDGWESKWVKSDWKRDENMAGEWNFTSGKWNGDANDKGIQTSEDYRFYAISAAFPEFSNKGKTLV Rco .....M NPK L LFL S..LLAIA NR K T Y P E D Npl MATQRR NPS LHLITVFSLLVAV S N R E K H E N Ath ...M KLNPKFI LILFA..LVVI I K KR K D T KH A N S E D Zma ..MAIRKGSSYAVAAL ALASVAA AG Q K E K H E EY D 101 200 Bst FQFSVKHEQKLDCGGGYMKLLSGDVDQKKFGGDTPYSIMFGPDICGYSTKKVHAILTKGETNHLIKKDVPCETDQLTHVYTFILRPDASYSILIDNVEKQ Rco SST NYND E LVI T Npl YND E T Ath D T YNG E V T Zma L V G S T DGK L I T E 201 300 Bst SGSVYTDWDILPPKQIKDPEAKKPEDWEDKEYIPDPEDKKPEGYDDIPKEITDPEAKKPEDWDDEEDGEWTAPTIPNPDYKGEWKPKKIKNPNFKGKWKA Rco T L L K DE P D A E P Y Npl L S L T S DE F D E D E P Y Ath T L S L A K S D T A P TD E N AY Zma T I EH K D P D E P Q YQ 301 400 Bst PMIDNPDFKDDPDIYVFPKLKYVGIELWQVKSGTMFDNVLICDDPDYAKKLAEETWGKNKDAEKAAFDEAEKKKEEEEAKDDPTESD.DEKPDEEGESDG Rco E Y N L N E Q E S AD A DD DADDTE Npl L L V L IV E AI Q E R S AA AD AE DD ADDD .D Ath E EL V SL VS E H R S A A AE EAEDDDNEGD Zma Y A DS I L II T AL TF H E D AKGGDDE D LEDE DD KAD Bst EGDDESKDIDNEE........DDEDVHDEL* Rco D G SDAA D........SA * Npl DA K ESK............. DEA * Ath DS N SEETK AEETKEAEETDAA * Zma DKAD DAE SKDS....... KQ * Figure 1. Alignment of the deduced amino acid sequences of calreticulin from Berberis stolonifera (Bst) with Ricinus communis (Rco), Nicotiana plumbaginifolia (Npl), Arabidopsis thaliana (Ath) and Zea mays (Zma). Plant Molecular Biology Springer Journals

Genbank accession number: AF052040

Plant Molecular Biology, Volume 37 (6) – Oct 6, 2004
1 page

Loading next page...
1 Page
Springer Journals
Copyright © 1998 by Kluwer Academic Publishers
Life Sciences; Biochemistry, general; Plant Sciences; Plant Pathology
Publisher site
See Article on Publisher Site


Plant Molecular Biology 37: 1085, 1998. © 1998 Kluwer Academic Publishers. Printed in Belgium. Sequence announcements Authors: Chou, W-M and Kutchan, TM Address: Laboratorium für Molekulare Biologie, Universität München, Karlstrasse 29, 80333 München, Germany Source of sequence: The cDNA was isolated from a ZAPII cDNA library prepared from mRNA isolated from cell suspension cultures of Berberis stolonifera (barberry) 3 days after subculture. The clone was sequenced in pBluescript SK obtained by in vivo excision of the phage  clone. Trivial name: Calreticulin from Berberis stolonifera. Description: The calreticulin cDNA clone is 1547 bp long and encodes a protein of 416 amino acids. The amino acid sequence is 50% identical to calreticulins from the animal kingdom. The cDNA was expressed in Spodoptera frugiperda Sf9 cells and was demonstrated to bind calcium. Acknowledgements: This work was supported by SFB 369 of the Deutsche Forschungsgemeinschaft, Bonn and Fonds der Chemischen Industrie, Frankfurt. 1 100 Bst ...MAIAERRSRSHLALR..VRDRVSAEVFFEERFEDGWESKWVKSDWKRDENMAGEWNFTSGKWNGDANDKGIQTSEDYRFYAISAAFPEFSNKGKTLV Rco .....M NPK L LFL S..LLAIA NR K T Y P E D Npl MATQRR NPS LHLITVFSLLVAV S N R E K H E N Ath ...M KLNPKFI LILFA..LVVI I K KR K D T KH A N S E D Zma ..MAIRKGSSYAVAAL ALASVAA AG Q K E K H E EY D 101 200 Bst FQFSVKHEQKLDCGGGYMKLLSGDVDQKKFGGDTPYSIMFGPDICGYSTKKVHAILTKGETNHLIKKDVPCETDQLTHVYTFILRPDASYSILIDNVEKQ Rco SST NYND E LVI T Npl YND E T Ath D T YNG E V T Zma L V G S T DGK L I T E 201 300 Bst SGSVYTDWDILPPKQIKDPEAKKPEDWEDKEYIPDPEDKKPEGYDDIPKEITDPEAKKPEDWDDEEDGEWTAPTIPNPDYKGEWKPKKIKNPNFKGKWKA Rco T L L K DE P D A E P Y Npl L S L T S DE F D E D E P Y Ath T L S L A K S D T A P TD E N AY Zma T I EH K D P D E P Q YQ 301 400 Bst PMIDNPDFKDDPDIYVFPKLKYVGIELWQVKSGTMFDNVLICDDPDYAKKLAEETWGKNKDAEKAAFDEAEKKKEEEEAKDDPTESD.DEKPDEEGESDG Rco E Y N L N E Q E S AD A DD DADDTE Npl L L V L IV E AI Q E R S AA AD AE DD ADDD .D Ath E EL V SL VS E H R S A A AE EAEDDDNEGD Zma Y A DS I L II T AL TF H E D AKGGDDE D LEDE DD KAD Bst EGDDESKDIDNEE........DDEDVHDEL* Rco D G SDAA D........SA * Npl DA K ESK............. DEA * Ath DS N SEETK AEETKEAEETDAA * Zma DKAD DAE SKDS....... KQ * Figure 1. Alignment of the deduced amino acid sequences of calreticulin from Berberis stolonifera (Bst) with Ricinus communis (Rco), Nicotiana plumbaginifolia (Npl), Arabidopsis thaliana (Ath) and Zea mays (Zma).


Plant Molecular BiologySpringer Journals

Published: Oct 6, 2004

There are no references for this article.

You’re reading a free preview. Subscribe to read the entire article.

DeepDyve is your
personal research library

It’s your single place to instantly
discover and read the research
that matters to you.

Enjoy affordable access to
over 18 million articles from more than
15,000 peer-reviewed journals.

All for just $49/month

Explore the DeepDyve Library


Query the DeepDyve database, plus search all of PubMed and Google Scholar seamlessly


Save any article or search result from DeepDyve, PubMed, and Google Scholar... all in one place.


Get unlimited, online access to over 18 million full-text articles from more than 15,000 scientific journals.

Your journals are on DeepDyve

Read from thousands of the leading scholarly journals from SpringerNature, Elsevier, Wiley-Blackwell, Oxford University Press and more.

All the latest content is available, no embargo periods.

See the journals in your area








Save searches from
Google Scholar,

Create lists to
organize your research

Export lists, citations

Read DeepDyve articles

Abstract access only

Unlimited access to over
18 million full-text articles


20 pages / month

PDF Discount

20% off