call for papers

call for papers JOM, Vol. 70, No. 7, 2018 https://doi.org/10.1007/s11837-018-2962-5 Ó 2018 The Minerals, Metals & Materials Society JO JOM is seeking contributions on the following topics for 2018 and 2019. For the full Editorial Calendar, along with author instructions, thejournal visit the JOM website at jom.tms.org. January 2019: Topic: Advanced Nanocomposite Materials: Manuscript Deadline: August 1, 2018 Structure-Property Relationships Topic: CFD Modeling and Simulation in Materials Scope:VWDJJHULQJDPRXQWRIH[SHULPHQWDODQG$ Processing WKHRUHWLFDOVWXGLHVKDYHEHHQGHGLFDWHGWRZDUGFUHDWLRQ Scope: This JOMWRSLFZLOOFRYHUFRPSXWDWLRQDOÀXLG RIXQLTXHQDQRFRPSRVLWHPDWHULDOVDQGXQGHUVWDQGLQJ JLFDOG\QDPLFV &)' PRGHOLQJDQGVLPXODWLRQRIPHWDOOXU $VWKHFRUUHODWLRQVEHWZHHQWKHLUVWUXFWXUHDQGSURSHUWLHV $GGLWLYHSURFHVVHVLQFOXGLQJEXWQRWOLPLWHGWR PDQ\FKHPLFDODQGSK\VLFDOLQWHUDFWLRQVDUHJRYHUQHGE\ $WRPL]DWLRQ,URQDQG6WHHOPDNLQJ0DQXIDFWXULQJ*DV VXUIDFHVVXUIDFHSURSHUWLHVDQGLQWHUIDFHVWKH\DUHYLWDOIRU HOGLQJ:HOGLQJ,QJRW&DVWLQJ)ULFWLRQ6WLU:)ULFWLRQ6WLU VVWUXFWXUHVDQGLQFRUSRUDWLQJ¿QHWXQLQJQDQRFRPSRVLWH¶ +LJK3UHVVXUH'LH&DVWLQJDQG&DVWLQJDQG6ROLGL¿FDWLRQ WKHPLQWRHYHU\GD\DSSOLFDWLRQV3DSHUVRQDOODVSHFWVRI ZLWK8OWUDVRQLFDQGRU(OHFWURPDJQHWLF)LHOG,QWHUDFWLRQV VWUXFWXUHSURSHUW\UHODWLRQVKLSVRIDGYDQFHGQDQRFRPSRVLWH Guest Editors:7KRPDV/LIHQJ/DXUHQWLX1DVWDF%ULDQ PDWHULDOVDUHLQYLWHG $GULDQ6DEDXDQG.RXOLV3HULFOHRXV=KDQJ Guest Editor:6LPRQD+XQ\DGL0XUSK Sponsors:HFKQRORJ\DQG0RGHOLQJ&RPPLWWHH73URFHVV Sponsor:&RPSRVLWHV&RPPLWWHH DQG6ROLGL¿FDWLRQ&RPPLWWHH Topic: Energy Materials Topic: Electric Arc Smelting Scope:7KLVWRSLFIRFXVHVRQUHVHDUFKIRUWKHSURGXFWLRQ Scope:7KHVFRSHRIWKLVWRSLFZRXOGHQFRPSDVVWKH SURFHVVLQJDQGFKDUDFWHUL]DWLRQRIPDWHULDOVRISRWHQWLDO SULPDU\VPHOWLQJRIPDWHULDOVLQHOHFWURGHIXUQDFHV J\J\WHFKQRORJLHVDQGHQHUJ\FRQYHUVLRQHQHUXVHLQHQHU LQFOXGLQJ&X1L3W6LDQGIHUURDOOR\VHQFRPSDVVLQJ 0DWHULDOVFRYHUHGLQFOXGHPHWDOOLFPDWHULDOVVXVWDLQDELOLW\ JLQJWHFKQRORJ\DQGIXUQDFHGHVLJQLQGXVWULDOWUHQGVHPHU VHPLFRQGXFWLQJPDWHULDOVQDQRPDWHULDOVRSWRHOHFWURQLF HOHFWURGHWHFKQRORJ\UHIUDFWRU\DQGIUHH]HOLQLQJVIXUQDFH DQGHQYLURQPHQWDOFRQWUROSURFHVVFRQWUROWDSSLQJVDIHW\ VRODUIXHOVELRPDVVWROLTXLGIXHOVWKHUPRHOHFWULF Guest Editors: :KLWH&DPLOOH)OHXULDXOWDQG-HVVH) PDWHULDOVHOHFWURGHPDWHULDOVIRUEDWWHULHVK\GURJHQ -RVHSK*URJDQ J\VDYLQJFDWDO\VWVIRUWKHFKHPLFDOLQGXVWU\VWRUDJHDQGHQHU Sponsor:J\&RPPLWWHH3\URPHWDOOXU Guest Editors:DQJDQG6KDGLD,NKPD\LHV:DR7 Sponsor:J\&RPPLWWHH(QHU February 2019: March 2019: Manuscript Deadline: September 1, 2018 Manuscript Deadline: October 1, 2018 Topic: Primary Aluminum Production Chain: Bauxite- Alumina-Electrode-Reduction Topic: Solid Freeform Fabrication Scope:7KLVWRSLFFRYHUVDOODVSHFWVRIWKHSULPDU\ Scope:7KLVLQYLWHGWRSLFZLOOIHDWXUHVHOHFWHGSDSHUVIURP DOXPLQXPSURGXFWLRQFKDLQLQFOXGLQJDOXPLQDUH¿QLQJ $QQXDO,QWHUQDWLRQDO6ROLG)UHHIRUP)DEULFDWLRQWKHWK IURPWKH%D\HUSURFHVVRUÀ\DVKSURGXFWLRQHOHFWURGH $GGLWLYH0DQXIDFWXULQJ&RQIHUHQFH6\PSRVLXP²$Q PDQXIDFWXULQJDQGWHFKQRORJLHVDQGDOXPLQXPUHGXFWLRQ 7KHH[DV7$XVWLQ$XJXVWLQVFKHGXOHGIRU HOHFWURO\VLVRUDOWHUQDWLYHSURFHVVHV PHHWLQJLVDPDMRUKLJKOHYHOUHVHDUFKFRQIHUHQFHGHDOLQJ Guest Editor:3DVFDO/DYRLH ZLWKDOODVSHFWVRIDGGLWLYHPDQXIDFWXULQJ Sponsor:J\DQG$OXPLQXP&RPPLWWHHDQG+\GURPHWDOOXU Guest Editor:'DYLG%RXUHOO J\&RPPLWWHH(OHFWURPHWDOOXU Sponsor:,QYLWHG PDWHULDOVDQGQRYHOSRO\PHUV$OVRLQFOXGHGDUHSKRWRYROWDLFV 1064 call for papers Topic: Effective Production and Recycling Topic: Protein-Based Structural Materials of Powder Materials Scope:6WUXFWXUDOSURWHLQVVXFKDVFROODJHQVLONRUNHUDWLQ Scope:7KLVWRSLFZLOOFRYHUPRVWO\SRZGHUPDWHULDOV H[KLELWYHU\LQWHUHVWLQJPHFKDQLFDOSURSHUWLHVDQGDUHVWXGLHG 7KLVWRSLFFDQLVVXHVUHODWHGWRSURGXFWLRQDQGUHF\FOLQJ EHHVSHFLDOO\UHOHYDQWWRDGGLWLYHPDQXIDFWXULQJ3RZGHU HLQYLWHFRQWULEXWLRQVUHJDUGLQJFKDUDFWHUL]DWLRQ:PDWHULDOV IHFWRQSURGXFWSURSHUWLHVDUHFRVWDQGHIUHXVDELOLW\ IRUWVLQFOXGLQJRIQDWXUDOSURWHLQPDWHULDOVV\QWKHVLVHI HVSHFLDOO\RILQWHUHVW V\QWKHWLFELRORJ\DSSURDFKHVDQGFRPSXWHUVLPXODWLRQVRU Guest Editor:.DWK\/X PRGHOLQJRIVXFKPDWHULDOVDFURVVWKHUHOHYDQWOHQJWKVFDOHV Sponsor:3RZGHU0DWHULDOV&RPPLWWHH Guest Editor: http://www.deepdyve.com/assets/images/DeepDyve-Logo-lg.png JOM Springer Journals

call for papers

JOM , Volume 70 (7) – May 31, 2018
Loading next page...
 
/lp/springer_journal/call-for-papers-QR3XMn1Er8
Publisher
Springer US
Copyright
Copyright © 2018 by The Minerals, Metals & Materials Society
Subject
Engineering; Engineering, general; Chemistry/Food Science, general; Physics, general; Environment, general; Earth Sciences, general
ISSN
1047-4838
eISSN
1543-1851
D.O.I.
10.1007/s11837-018-2962-5
Publisher site
See Article on Publisher Site

Abstract

JOM, Vol. 70, No. 7, 2018 https://doi.org/10.1007/s11837-018-2962-5 Ó 2018 The Minerals, Metals & Materials Society JO JOM is seeking contributions on the following topics for 2018 and 2019. For the full Editorial Calendar, along with author instructions, thejournal visit the JOM website at jom.tms.org. January 2019: Topic: Advanced Nanocomposite Materials: Manuscript Deadline: August 1, 2018 Structure-Property Relationships Topic: CFD Modeling and Simulation in Materials Scope:VWDJJHULQJDPRXQWRIH[SHULPHQWDODQG$ Processing WKHRUHWLFDOVWXGLHVKDYHEHHQGHGLFDWHGWRZDUGFUHDWLRQ Scope: This JOMWRSLFZLOOFRYHUFRPSXWDWLRQDOÀXLG RIXQLTXHQDQRFRPSRVLWHPDWHULDOVDQGXQGHUVWDQGLQJ JLFDOG\QDPLFV &)' PRGHOLQJDQGVLPXODWLRQRIPHWDOOXU $VWKHFRUUHODWLRQVEHWZHHQWKHLUVWUXFWXUHDQGSURSHUWLHV $GGLWLYHSURFHVVHVLQFOXGLQJEXWQRWOLPLWHGWR PDQ\FKHPLFDODQGSK\VLFDOLQWHUDFWLRQVDUHJRYHUQHGE\ $WRPL]DWLRQ,URQDQG6WHHOPDNLQJ0DQXIDFWXULQJ*DV VXUIDFHVVXUIDFHSURSHUWLHVDQGLQWHUIDFHVWKH\DUHYLWDOIRU HOGLQJ:HOGLQJ,QJRW&DVWLQJ)ULFWLRQ6WLU:)ULFWLRQ6WLU VVWUXFWXUHVDQGLQFRUSRUDWLQJ¿QHWXQLQJQDQRFRPSRVLWH¶ +LJK3UHVVXUH'LH&DVWLQJDQG&DVWLQJDQG6ROLGL¿FDWLRQ WKHPLQWRHYHU\GD\DSSOLFDWLRQV3DSHUVRQDOODVSHFWVRI ZLWK8OWUDVRQLFDQGRU(OHFWURPDJQHWLF)LHOG,QWHUDFWLRQV VWUXFWXUHSURSHUW\UHODWLRQVKLSVRIDGYDQFHGQDQRFRPSRVLWH Guest Editors:7KRPDV/LIHQJ/DXUHQWLX1DVWDF%ULDQ PDWHULDOVDUHLQYLWHG $GULDQ6DEDXDQG.RXOLV3HULFOHRXV=KDQJ Guest Editor:6LPRQD+XQ\DGL0XUSK Sponsors:HFKQRORJ\DQG0RGHOLQJ&RPPLWWHH73URFHVV Sponsor:&RPSRVLWHV&RPPLWWHH DQG6ROLGL¿FDWLRQ&RPPLWWHH Topic: Energy Materials Topic: Electric Arc Smelting Scope:7KLVWRSLFIRFXVHVRQUHVHDUFKIRUWKHSURGXFWLRQ Scope:7KHVFRSHRIWKLVWRSLFZRXOGHQFRPSDVVWKH SURFHVVLQJDQGFKDUDFWHUL]DWLRQRIPDWHULDOVRISRWHQWLDO SULPDU\VPHOWLQJRIPDWHULDOVLQHOHFWURGHIXUQDFHV J\J\WHFKQRORJLHVDQGHQHUJ\FRQYHUVLRQHQHUXVHLQHQHU LQFOXGLQJ&X1L3W6LDQGIHUURDOOR\VHQFRPSDVVLQJ 0DWHULDOVFRYHUHGLQFOXGHPHWDOOLFPDWHULDOVVXVWDLQDELOLW\ JLQJWHFKQRORJ\DQGIXUQDFHGHVLJQLQGXVWULDOWUHQGVHPHU VHPLFRQGXFWLQJPDWHULDOVQDQRPDWHULDOVRSWRHOHFWURQLF HOHFWURGHWHFKQRORJ\UHIUDFWRU\DQGIUHH]HOLQLQJVIXUQDFH DQGHQYLURQPHQWDOFRQWUROSURFHVVFRQWUROWDSSLQJVDIHW\ VRODUIXHOVELRPDVVWROLTXLGIXHOVWKHUPRHOHFWULF Guest Editors: :KLWH&DPLOOH)OHXULDXOWDQG-HVVH) PDWHULDOVHOHFWURGHPDWHULDOVIRUEDWWHULHVK\GURJHQ -RVHSK*URJDQ J\VDYLQJFDWDO\VWVIRUWKHFKHPLFDOLQGXVWU\VWRUDJHDQGHQHU Sponsor:J\&RPPLWWHH3\URPHWDOOXU Guest Editors:DQJDQG6KDGLD,NKPD\LHV:DR7 Sponsor:J\&RPPLWWHH(QHU February 2019: March 2019: Manuscript Deadline: September 1, 2018 Manuscript Deadline: October 1, 2018 Topic: Primary Aluminum Production Chain: Bauxite- Alumina-Electrode-Reduction Topic: Solid Freeform Fabrication Scope:7KLVWRSLFFRYHUVDOODVSHFWVRIWKHSULPDU\ Scope:7KLVLQYLWHGWRSLFZLOOIHDWXUHVHOHFWHGSDSHUVIURP DOXPLQXPSURGXFWLRQFKDLQLQFOXGLQJDOXPLQDUH¿QLQJ $QQXDO,QWHUQDWLRQDO6ROLG)UHHIRUP)DEULFDWLRQWKHWK IURPWKH%D\HUSURFHVVRUÀ\DVKSURGXFWLRQHOHFWURGH $GGLWLYH0DQXIDFWXULQJ&RQIHUHQFH6\PSRVLXP²$Q PDQXIDFWXULQJDQGWHFKQRORJLHVDQGDOXPLQXPUHGXFWLRQ 7KHH[DV7$XVWLQ$XJXVWLQVFKHGXOHGIRU HOHFWURO\VLVRUDOWHUQDWLYHSURFHVVHV PHHWLQJLVDPDMRUKLJKOHYHOUHVHDUFKFRQIHUHQFHGHDOLQJ Guest Editor:3DVFDO/DYRLH ZLWKDOODVSHFWVRIDGGLWLYHPDQXIDFWXULQJ Sponsor:J\DQG$OXPLQXP&RPPLWWHHDQG+\GURPHWDOOXU Guest Editor:'DYLG%RXUHOO J\&RPPLWWHH(OHFWURPHWDOOXU Sponsor:,QYLWHG PDWHULDOVDQGQRYHOSRO\PHUV$OVRLQFOXGHGDUHSKRWRYROWDLFV 1064 call for papers Topic: Effective Production and Recycling Topic: Protein-Based Structural Materials of Powder Materials Scope:6WUXFWXUDOSURWHLQVVXFKDVFROODJHQVLONRUNHUDWLQ Scope:7KLVWRSLFZLOOFRYHUPRVWO\SRZGHUPDWHULDOV H[KLELWYHU\LQWHUHVWLQJPHFKDQLFDOSURSHUWLHVDQGDUHVWXGLHG 7KLVWRSLFFDQLVVXHVUHODWHGWRSURGXFWLRQDQGUHF\FOLQJ EHHVSHFLDOO\UHOHYDQWWRDGGLWLYHPDQXIDFWXULQJ3RZGHU HLQYLWHFRQWULEXWLRQVUHJDUGLQJFKDUDFWHUL]DWLRQ:PDWHULDOV IHFWRQSURGXFWSURSHUWLHVDUHFRVWDQGHIUHXVDELOLW\ IRUWVLQFOXGLQJRIQDWXUDOSURWHLQPDWHULDOVV\QWKHVLVHI HVSHFLDOO\RILQWHUHVW V\QWKHWLFELRORJ\DSSURDFKHVDQGFRPSXWHUVLPXODWLRQVRU Guest Editor:.DWK\/X PRGHOLQJRIVXFKPDWHULDOVDFURVVWKHUHOHYDQWOHQJWKVFDOHV Sponsor:3RZGHU0DWHULDOV&RPPLWWHH Guest Editor:

Journal

JOMSpringer Journals

Published: May 31, 2018

There are no references for this article.

You’re reading a free preview. Subscribe to read the entire article.


DeepDyve is your
personal research library

It’s your single place to instantly
discover and read the research
that matters to you.

Enjoy affordable access to
over 18 million articles from more than
15,000 peer-reviewed journals.

All for just $49/month

Explore the DeepDyve Library

Search

Query the DeepDyve database, plus search all of PubMed and Google Scholar seamlessly

Organize

Save any article or search result from DeepDyve, PubMed, and Google Scholar... all in one place.

Access

Get unlimited, online access to over 18 million full-text articles from more than 15,000 scientific journals.

Your journals are on DeepDyve

Read from thousands of the leading scholarly journals from SpringerNature, Elsevier, Wiley-Blackwell, Oxford University Press and more.

All the latest content is available, no embargo periods.

See the journals in your area

DeepDyve

Freelancer

DeepDyve

Pro

Price

FREE

$49/month
$360/year

Save searches from
Google Scholar,
PubMed

Create lists to
organize your research

Export lists, citations

Read DeepDyve articles

Abstract access only

Unlimited access to over
18 million full-text articles

Print

20 pages / month

PDF Discount

20% off