Crotamine is a novel cell-penetrating protein from the venom of rattlesnake Crotalus durissus terrific us ALEXANDRE KERKIS * ,1 , 2 , IRINA KERKIS * , 2 , GANDHI RÁDIS-BAPTISTA † , EDUARDO B. OLIVEIRA ‡ , ANGELA M. VIANNA-MORGANTE * , LYGIA V. PEREIRA * and TETSUO YAMANE † * Departmento de Biologia, Instituto de Biociências, Universidade de São Paulo, São Paulo; † Laboratório de Toxinologia Molecular, Instituto Butantan, São Paulo; and ‡ Departmento de Bioquímica e Imunologia, Universidade de São Paulo, Ribeirão Preto, SP, Brasil 1 Correspondence: Departamento de Biologia, Instituto de Biociências, Universidade de São Paulo, Rua do Matão, 277, 05508-900, São Paulo, SP, Brasil. E-mail: akerkis@usp.br <h3>SPECIFIC AIMS</h3> Peptides rich in basic arginine and lysine residues can be internalized by cells in vitro and in vivo and have been used for intracellular delivery of genes, therapeutic agents, and diagnostic probes. Crotamine, a toxin from the venom of the South American rattlesnake, is a 42 amino acid cationic polypeptide (YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGS—G)containing 11 basic residues (9 lysines, 2 arginines) and 6 cysteines. We evaluated the cytotoxicity of crotamine in murine ES cells. Embryotoxicity was tested in vitro in preimplantation stages (morulae/blastocysts) of the mouse embryo. Uptake of
/lp/fed-of-american-socs-for-experimental-biology/crotamine-is-a-novel-cell-penetrating-protein-from-the-venom-of-JfI98kMalg