Search

Filter

  • Advanced Filters:

  • to
  • Specific Data Sources:

    All Edit

    Select All  |  Select None

Reset filters

Crotamine is a novel cell-penetrating protein from the venom of rattlesnake Crotalus durissus terrific us ALEXANDRE KERKIS * ,1 , 2 , IRINA KERKIS * , 2 , GANDHI RÁDIS-BAPTISTA † , EDUARDO B. OLIVEIRA ‡ , ANGELA M. VIANNA-MORGANTE * , LYGIA V. PEREIRA * and TETSUO YAMANE † * Departmento de Biologia, Instituto de Biociências, Universidade de São Paulo, São Paulo; † Laboratório de Toxinologia Molecular, Instituto Butantan, São Paulo; and ‡ Departmento de Bioquímica e Imunologia, Universidade de São Paulo, Ribeirão Preto, SP, Brasil 1 Correspondence: Departamento de Biologia, Instituto de Biociências, Universidade de São Paulo, Rua do Matão, 277, 05508-900, São Paulo, SP, Brasil. E-mail: akerkis@usp.br <h3>SPECIFIC AIMS</h3> Peptides rich in basic arginine and lysine residues can be internalized by cells in vitro and in vivo and have been used for intracellular delivery of genes, therapeutic agents, and diagnostic probes. Crotamine, a toxin from the venom of the South American rattlesnake, is a 42 amino acid cationic polypeptide (YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGS—G)containing 11 basic residues (9 lysines, 2 arginines) and 6 cysteines. We evaluated the cytotoxicity of crotamine in murine ES cells. Embryotoxicity was tested in vitro in preimplantation stages (morulae/blastocysts) of the mouse embryo. Uptake of

End of preview. The entire article is 3 pages. To view the full-text, please rent this article to continue.

/lp/fed-of-american-socs-for-experimental-biology/crotamine-is-a-novel-cell-penetrating-protein-from-the-venom-of-JfI98kMalg
Welcome to DeepDyve! Rent Premier Research Articles and Save Up to 90%

Learn more

Bookmark

Crotamine is a novel cell-penetrating protein from the venom of rattlesnake Crotalus durissus terrificus

More Info

More Like This Article

View All dataSource[]=actageo&dataSource[]=aspet&dataSource[]=aaos&dataSource[]=aacc&dataSource[]=aacr&dataSource[]=aea&dataSource[]=aip&dataSource[]=ajnr&dataSource[]=ams&dataSource[]=aps_physical&dataSource[]=appi_book&dataSource[]=appi_journal&dataSource[]=apha&dataSource[]=asip&dataSource[]=asm&dataSource[]=asn&dataSource[]=aspb&dataSource[]=avs&dataSource[]=annual_reviews&dataSource[]=arxiv&dataSource[]=acm&dataSource[]=berghahn&dataSource[]=cabi&dataSource[]=clinical_trials&dataSource[]=dailymed&dataSource[]=degruyter&dataSource[]=du_press&dataSource[]=esa&dataSource[]=eu_press&dataSource[]=elsevier&dataSource[]=emerald&dataSource[]=ejtr&dataSource[]=emea&dataSource[]=epo&dataSource[]=faseb&dataSource[]=gsa&dataSource[]=health_affairs&dataSource[]=hindawi&dataSource[]=imanager&dataSource[]=imedpub&dataSource[]=informa_healthcare&dataSource[]=informs&dataSource[]=iop&dataSource[]=iucr&dataSource[]=iospress&dataSource[]=jbjs&dataSource[]=leftcoast&dataSource[]=lu_press&dataSource[]=mesharpe&dataSource[]=mary_ann_liebert&dataSource[]=medline&dataSource[]=mit_press&dataSource[]=nature&dataSource[]=oxford&dataSource[]=pier_professional&dataSource[]=pnas&dataSource[]=portlandpress&dataSource[]=psyc_articles&dataSource[]=psyc_books&dataSource[]=psyc_critiques&dataSource[]=plos_journal&dataSource[]=pubmed_central&dataSource[]=rsna&dataSource[]=rockefeller&dataSource[]=rcn&dataSource[]=ria&dataSource[]=rsc&dataSource[]=sage&dataSource[]=spie&dataSource[]=springer_journal&dataSource[]=springer&dataSource[]=taylor_francis&dataSource[]=aps&dataSource[]=the_scientist&dataSource[]=uc_press&dataSource[]=uspto_abstract&dataSource[]=wiley&dataSource[]=pct

Browse: Subject Areas | Journals | Publishers

Sign Up for a DeepDyve Account

Bookmark an Article

To bookmark an article, please log in first, or sign up for a DeepDyve account if you don't already have one.

OK

Subscribe to Journal Email Alerts

To subscribe to email alerts, please log in first, or sign up for a DeepDyve account if you don't already have one.

OK

Thank you for renting with DeepDyve

Your PayPal account has been charged $2.99. You now have access to the full text of this article. A rental receipt has also been sent to your email address.

Your credit card has been charged $2.99. You now have access to the full text of this article. A rental receipt has also been sent to your email address.

OK

New! You can now keep track of new articles from The FASEB Journal on your personalized homepage! Learn more

PDF Download — Not Available

Thanks for your interest in purchasing the PDF. Your request has been noted and we will work with our publisher partner to discuss enabling this feature.

In the meantime, you can get the PDF by visiting the publisher site.

Thank you for purchasing with DeepDyve

Your PayPal account has been charged $.

Your credit card has been charged $.

You can now download this article. A purchase receipt has also been sent to your email address.

Download This Article or I'm done with my download

Article Printing

To print this article, please log in first, or sign up for a DeepDyve account if you don't already have one.

Thank you for printing with DeepDyve

Your PayPal account has been charged $0.

Your credit card has been charged $0.

You can now print this article. A purchase receipt has also been sent to your email address.

Print the Selected Pages or I'm done with my printing

Please refresh to generate a new download link

Your article download link has expired. Please refresh this page to obtain a new download link and try again.

Follow a Journal

To get new article updates from a journal on your personalized homepage, please log in first, or sign up for a DeepDyve account if you don't already have one.

OK